Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 30 (TVA30), Biotinylated

This Recombinant Human T cell receptor alpha variable 30 (TVA30), Biotinylated spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 30 TRAV30

UniProt

A0A087WSZ9

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQPVQSPQAVILREGEDAVINCSSSKALYSVHWYRQKHGEAPVFLMILLKGGEQKGHDKISASFNEKKQQSSLYLTASQLSYSGTYFCGTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PIMREG activation kit by CRISPRa
GA110128 1 Kit

Human PIMREG activation kit by CRISPRa

Sign In for Pricing
View Details
F8A3 Human Gene Knockout Kit (CRISPR)
KN417606 1 Kit

F8A3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD50/ICAM-3 (Ab-518) Antibody
8B0850-AAT 50 µg

CD50/ICAM-3 (Ab-518) Antibody

Sign In for Pricing
View Details
Aminoacylase 1 (ACY1) (NM_001198897) Human Over-expression Lysate
LC434175 20 µg

Aminoacylase 1 (ACY1) (NM_001198897) Human Over-expression Lysate

Sign In for Pricing
View Details
NEUROD1 (NM_002500) Human Over-expression Lysate
LC400891 20 µg

NEUROD1 (NM_002500) Human Over-expression Lysate

Sign In for Pricing
View Details
TentaGel® S HMBA
S30014.1G 1 g

TentaGel® S HMBA

Sign In for Pricing
View Details