Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 30 (TVA30), Biotinylated

This Recombinant Human T cell receptor alpha variable 30 (TVA30), Biotinylated spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 30 TRAV30

UniProt

A0A087WSZ9

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQPVQSPQAVILREGEDAVINCSSSKALYSVHWYRQKHGEAPVFLMILLKGGEQKGHDKISASFNEKKQQSSLYLTASQLSYSGTYFCGTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Gigaxonin (GAN) ELISA Kit
RD-GAN-Hu-01 96 Tests

Human Gigaxonin (GAN) ELISA Kit

Sign In for Pricing
View Details
Human Gigaxonin (GAN) ELISA Kit
RD-GAN-Hu-02 48 Tests

Human Gigaxonin (GAN) ELISA Kit

Sign In for Pricing
View Details
Triundecanoin-d5
TRC-T891752-50MG 50 mg

Triundecanoin-d5

Sign In for Pricing
View Details
CD66 (CEA) (C66/261), CF640R conjugate, 0.1mg/mL
BNC400261-100 1x 100 µL

CD66 (CEA) (C66/261), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL 2 Rat
OM296640-01 20 µg

IL 2 Rat

Sign In for Pricing
View Details
IL 2 Rat
OM296640-02 5 µg

IL 2 Rat

Sign In for Pricing
View Details