Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 30 (TVA30), Biotinylated

This Recombinant Human T cell receptor alpha variable 30 (TVA30), Biotinylated spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 30 TRAV30

UniProt

A0A087WSZ9

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQPVQSPQAVILREGEDAVINCSSSKALYSVHWYRQKHGEAPVFLMILLKGGEQKGHDKISASFNEKKQQSSLYLTASQLSYSGTYFCGTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Buccutite™ Rapid APC Antibody Labeling Kit *Microscale Optimized for Labeling 25 ug Antibody Per Reaction*
1313-AAT 2 Labelings

Buccutite™ Rapid APC Antibody Labeling Kit *Microscale Optimized for Labeling 25 ug Antibody Per Reaction*

Sign In for Pricing
View Details
EBAG9 (NM_198120) Human Recombinant Protein
TP315667 20 µg

EBAG9 (NM_198120) Human Recombinant Protein

Sign In for Pricing
View Details
HOXA7 Rabbit Polyclonal Antibody
TA366894 100 µL

HOXA7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Desmoglein-3 (Squamous Cell Marker) (DSG3/2796), CF405S conjugate, 0.1mg/mL
BNC042796-100 1x 100 µL

Desmoglein-3 (Squamous Cell Marker) (DSG3/2796), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rex1bd Mouse Gene Knockout Kit (CRISPR)
KN500301 1 Kit

Rex1bd Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CARD15 (NOD2) Human Gene Knockout Kit (CRISPR)
KN215750BN 1 Kit

CARD15 (NOD2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details