Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 9-2 (TVA92), Biotinylated

This Recombinant Human T cell receptor alpha variable 9-2 (TVA92), Biotinylated spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 9-2 TRAV9-2

UniProt

A0A087WT02

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYRKETTSFHLEKGSVQVSDSAVYFCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tm9sf1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6619507 1.0 µg DNA

Tm9sf1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
FCAMR Protein Vector (Human) (pPM-C-His)
PV078084 500 ng

FCAMR Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
CD3G Rabbit mAb
C06063-20uL 20 µL

CD3G Rabbit mAb

Sign In for Pricing
View Details
FBXO18 shRNA (h) Lentiviral Particles
sc-90469-V 200 µL

FBXO18 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
FAM122C Protein Vector (Mouse) (pPB-C-His)
PV177202 500 ng

FAM122C Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
MUS81 ORF Vector (Human) (pORF)
ORF006803 1.0 µg DNA

MUS81 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details