Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 9-2 (TVA92), Biotinylated

This Recombinant Human T cell receptor alpha variable 9-2 (TVA92), Biotinylated spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 9-2 TRAV9-2

UniProt

A0A087WT02

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYRKETTSFHLEKGSVQVSDSAVYFCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-REXO2 Antibody Picoband®, FITC Conjugate
A10835-1-FITC 100 µg/Vial

Anti-REXO2 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
HSPA12B (NM_052970) Human Over-expression Lysate
LS116835 100 µg

HSPA12B (NM_052970) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Saccharomyces Cerevisiae ORC5 Protein (aa 1-479) [His]
VAng-Wyb5213-1mg 1 mg

Recombinant Saccharomyces Cerevisiae ORC5 Protein (aa 1-479) [His]

Sign In for Pricing
View Details
SETBP1 Antibody
22-788 100 µL

SETBP1 Antibody

Sign In for Pricing
View Details
Phospho-H2AX (Ser139) Rabbit Polyclonal Antibody (BF488)
orb1581373 100 µL

Phospho-H2AX (Ser139) Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
PCNA Antibody
MBS8584375-01 0.1 mL

PCNA Antibody

Sign In for Pricing
View Details