Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 9-2 (TVA92), Biotinylated

This Recombinant Human T cell receptor alpha variable 9-2 (TVA92), Biotinylated spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 9-2 TRAV9-2

UniProt

A0A087WT02

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYRKETTSFHLEKGSVQVSDSAVYFCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Titanium (IV) isopropoxide
sc-253704A 2 Kg

Titanium (IV) isopropoxide

Sign In for Pricing
View Details
Involucrin (BSA & Azide Free) (APC) discontinued
I8447-25X-APC 100 µL

Involucrin (BSA & Azide Free) (APC) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal beta 2-Microglobulin Antibody (B2M/961) [PE]
NBP2-47704PE 0.1 mL

Mouse Monoclonal beta 2-Microglobulin Antibody (B2M/961) [PE]

Sign In for Pricing
View Details
Avanafil Impurity 73
RM-A164199-01 10 mg

Avanafil Impurity 73

Sign In for Pricing
View Details
Avanafil Impurity 73
RM-A164199-02 25 mg

Avanafil Impurity 73

Sign In for Pricing
View Details
Avanafil Impurity 73
RM-A164199-03 50 mg

Avanafil Impurity 73

Sign In for Pricing
View Details