Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 16 (TVB16), Biotinylated

This Recombinant Human T cell receptor beta variable 16 (TVB16), Biotinylated spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 16 TRBV16

UniProt

A0A087WV62

Expression Region

21-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EEVAQTPKHLVRGEGQKAKLYCAPIKGHSYVFWYQQVLKNEFKFLISFQNENVFDETGMPKERFSAKCLPNSPCSLEIQATKLEDSAVYFCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ESPN Antibody Picoband® Fluoro488 Conjugated
A06536-Fluoro488 100 µg/Vial

Anti-ESPN Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
mCherry Monoclonal Antibody
A10128-100UG 100 µg

mCherry Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal integrin beta 4 binding protein Antibody [Alexa Fluor 350]
NBP1-52641AF350 0.1 mL

Rabbit Polyclonal integrin beta 4 binding protein Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Guinea pig Complement 1q ELISA Kit
MBS729001-01 48 Well

Guinea pig Complement 1q ELISA Kit

Sign In for Pricing
View Details
Guinea pig Complement 1q ELISA Kit
MBS729001-02 96 Well

Guinea pig Complement 1q ELISA Kit

Sign In for Pricing
View Details
Guinea pig Complement 1q ELISA Kit
MBS729001-03 5x 96 Well

Guinea pig Complement 1q ELISA Kit

Sign In for Pricing
View Details