Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-40 (KV240), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 2-40 (KV240), Biotinylated spans the amino acid sequence from region 20-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-40 IGKV2-40

UniProt

A0A087WW87

Expression Region

20-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDDGNTYLDWYLQKPGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQRIEFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ficolin-1
AP83552 1 mg

Ficolin-1

Sign In for Pricing
View Details
EGFL7 Antibody
A48637-50UL 50 μL

EGFL7 Antibody

Sign In for Pricing
View Details
Research Grade Tilavonemab
DHC82403 100 μg

Research Grade Tilavonemab

Sign In for Pricing
View Details
BTF3 Protein Vector (Mouse) (pPB-C-His)
PV160110 500 ng

BTF3 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Peripherin (Prph, Prph1) (Not for Export EU)
031421 100 µL

Peripherin (Prph, Prph1) (Not for Export EU)

Sign In for Pricing
View Details
Rabbit Polyclonal ARC/NOL3 Antibody [HRP]
NBP2-41753H 0.1 mL

Rabbit Polyclonal ARC/NOL3 Antibody [HRP]

Sign In for Pricing
View Details