Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 17 (TVB17), Biotinylated

This Recombinant Human Probable non-functional T cell receptor beta variable 17 (TVB17), Biotinylated spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 17 TRBV17

UniProt

A0A087X0K7

Expression Region

20-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EPGVSQTPRHKVTNMGQEVILRCDPSSGHMFVHWYRQNLRQEMKLLISFQYQNIAVDSGMPKERFTAERPNGTSSTLKIHPAEPRDSAVYLYSSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Myosin Heavy Chain 1, Skeletal Muscle, Adult (MYH1) ELISA Kit
abx570236 96 Well

Human Myosin Heavy Chain 1, Skeletal Muscle, Adult (MYH1) ELISA Kit

Sign In for Pricing
View Details
Wdr62 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4653307 1.0 µg DNA

Wdr62 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Total Amino Acids (T-AA) Colorimetric Assay Kit
E-BC-K055-S-01 50 Assays (36 samples)

Total Amino Acids (T-AA) Colorimetric Assay Kit

Sign In for Pricing
View Details
Total Amino Acids (T-AA) Colorimetric Assay Kit
E-BC-K055-S-02 100 Assays (86 samples)

Total Amino Acids (T-AA) Colorimetric Assay Kit

Sign In for Pricing
View Details
1, 3-Bis (2, 6-di-i-propylphenyl) imidazolidin-2-ylidene) (2-i-propoxy-5-nitrobenzylidene) ruthenium (II) dichloride Nitro-Grela SiPr
B3600-01 25 mg

1, 3-Bis (2, 6-di-i-propylphenyl) imidazolidin-2-ylidene) (2-i-propoxy-5-nitrobenzylidene) ruthenium (II) dichloride Nitro-Grela SiPr

Sign In for Pricing
View Details
1, 3-Bis (2, 6-di-i-propylphenyl) imidazolidin-2-ylidene) (2-i-propoxy-5-nitrobenzylidene) ruthenium (II) dichloride Nitro-Grela SiPr
B3600-02 100 mg

1, 3-Bis (2, 6-di-i-propylphenyl) imidazolidin-2-ylidene) (2-i-propoxy-5-nitrobenzylidene) ruthenium (II) dichloride Nitro-Grela SiPr

Sign In for Pricing
View Details