Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 17 (TVB17), Biotinylated

This Recombinant Human Probable non-functional T cell receptor beta variable 17 (TVB17), Biotinylated spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 17 TRBV17

UniProt

A0A087X0K7

Expression Region

20-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EPGVSQTPRHKVTNMGQEVILRCDPSSGHMFVHWYRQNLRQEMKLLISFQYQNIAVDSGMPKERFTAERPNGTSSTLKIHPAEPRDSAVYLYSSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine C-Peptide,connecting peptide ELISA Kit
CELI-66099p 96 Tests

Porcine C-Peptide,connecting peptide ELISA Kit

Sign In for Pricing
View Details
Intermedine-D7
sc-491187-CW 500 µg

Intermedine-D7

Sign In for Pricing
View Details
Eukaryotic Anti-Mullerian Hormone (AMH)
RPU59099-01 50 µg

Eukaryotic Anti-Mullerian Hormone (AMH)

Sign In for Pricing
View Details
Eukaryotic Anti-Mullerian Hormone (AMH)
RPU59099-02 100 µg

Eukaryotic Anti-Mullerian Hormone (AMH)

Sign In for Pricing
View Details
Eukaryotic Anti-Mullerian Hormone (AMH)
RPU59099-03 1 mg

Eukaryotic Anti-Mullerian Hormone (AMH)

Sign In for Pricing
View Details
Omni Klentaq LA
350 125 µL (500x 25 µL Reactions)

Omni Klentaq LA

Sign In for Pricing
View Details