Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 18 (TVB18), Biotinylated

This Recombinant Human T cell receptor beta variable 18 (TVB18), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 18 TRBV18

UniProt

A0A087X0M5

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVMQNPRHLVRRRGQEARLRCSPMKGHSHVYWYRQLPEEGLKFMVYLQKENIIDESGMPKERFSAEFPKEGPSILRIQQVVRGDSAAYFCASSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20/MS4A1 Mouse Monoclonal Antibody (Fluoro647)
orb3084466 100 µg

CD20/MS4A1 Mouse Monoclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Rabbit Anti-Rat Vasoactive Intestinal Peptide (VIP) Polyclonal Antibody
VD1N457 1 Each

Rabbit Anti-Rat Vasoactive Intestinal Peptide (VIP) Polyclonal Antibody

Sign In for Pricing
View Details
SARS-CoV-2 Nucleocapsid Recombinant Protein
TP790189 20 µg

SARS-CoV-2 Nucleocapsid Recombinant Protein

Sign In for Pricing
View Details
Mmu-miR-1249-5p miRNA Inhibitor
CIM0673-01 10 nmol

Mmu-miR-1249-5p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-1249-5p miRNA Inhibitor
CIM0673-02 20 nmol

Mmu-miR-1249-5p miRNA Inhibitor

Sign In for Pricing
View Details
HSP27 Antibody
E18-6082-1 50 µg - 50 µL

HSP27 Antibody

Sign In for Pricing
View Details