Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2D-26 (KVD26), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 2D-26 (KVD26), Biotinylated spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2D-26 IGKV2D-26

UniProt

A0A0A0MRZ7

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVMTQTPLSLSITPGEQASMSCRSSQSLLHSDGYTYLYWFLQKARPVSTLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDFGVYYCMQDAQDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Csf2ra Rat siRNA Oligo Duplex (Locus ID 652957)
SR503849 1 Kit

Csf2ra Rat siRNA Oligo Duplex (Locus ID 652957)

Sign In for Pricing
View Details
FineTest®488 Anti-Mouse CD122 Antibody (TM-Beta 1)
F488-30212-01 50 Tests

FineTest®488 Anti-Mouse CD122 Antibody (TM-Beta 1)

Sign In for Pricing
View Details
FineTest®488 Anti-Mouse CD122 Antibody (TM-Beta 1)
F488-30212-02 100 Tests

FineTest®488 Anti-Mouse CD122 Antibody (TM-Beta 1)

Sign In for Pricing
View Details
SMARCD3 Protein Vector (Human) (pPM-C-HA)
44418021 500 ng

SMARCD3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Smg6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
44450114 3x 1.0 µg

Smg6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
PPCS Antibody - N-terminal region
ARP63676_P050-25UL 25 µL

PPCS Antibody - N-terminal region

Sign In for Pricing
View Details