Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2D-26 (KVD26), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 2D-26 (KVD26), Biotinylated spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2D-26 IGKV2D-26

UniProt

A0A0A0MRZ7

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVMTQTPLSLSITPGEQASMSCRSSQSLLHSDGYTYLYWFLQKARPVSTLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDFGVYYCMQDAQDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO6 (F-box Only Protein 6, F-Box/G-domain Protein 2, F-box Protein That Recognizes Sugar Chains 2, FBG 2, FBG2, FBX 6, FBX6)
126705 100 µg

FBXO6 (F-box Only Protein 6, F-Box/G-domain Protein 2, F-box Protein That Recognizes Sugar Chains 2, FBG 2, FBG2, FBX 6, FBX6)

Sign In for Pricing
View Details
FAK Rabbit mAb
F0431-20ul 20 µL

FAK Rabbit mAb

Sign In for Pricing
View Details
Fank1 3'UTR GFP Stable Cell Line
TU254442 1.0 mL

Fank1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Pol II (F-12) : m-IgG2b BP-HRP Bundle
sc-549597 1 Kit

Pol II (F-12) : m-IgG2b BP-HRP Bundle

Sign In for Pricing
View Details
CEBPD, NT (CEBPD, CCAAT/enhancer-binding protein delta, Nuclear factor NF-IL6-beta) (FITC) discontinued
033750-FITC 200 µL

CEBPD, NT (CEBPD, CCAAT/enhancer-binding protein delta, Nuclear factor NF-IL6-beta) (FITC) discontinued

Sign In for Pricing
View Details
Tsga10 Mouse qPCR Primer Pair (NM_207228)
MP216800 200 Reactions

Tsga10 Mouse qPCR Primer Pair (NM_207228)

Sign In for Pricing
View Details