Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-11 (KVD11), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 3D-11 (KVD11), Biotinylated spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-11 IGKV3D-11

UniProt

A0A0A0MRZ8

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGPGTDFTLTISSLEPEDFAVYYCQQRSNWH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATTO 532
E37F532-1-100-mg 100mg

ATTO 532

Sign In for Pricing
View Details
ATP6V1G3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
12808066 1.0 µg DNA

ATP6V1G3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human MLLT3 (MLLT3 super elongation complex subunit) Expressed in vitro E.coli expression system, Full Length
MPX0975K Each

Magic™ Membrane Protein Human MLLT3 (MLLT3 super elongation complex subunit) Expressed in vitro E.coli expression system, Full Length

Sign In for Pricing
View Details
Recombinant Mycoplasma Pneumoniae MPN_635 Protein (aa 1-352)
VAng-Lsx05070-1mgEcoli 1 mg (E. coli)

Recombinant Mycoplasma Pneumoniae MPN_635 Protein (aa 1-352)

Sign In for Pricing
View Details
Ornithine Carbamoyltransferase (OTC) Mouse Monoclonal Antibody [Clone ID: LBI5A7]
AMM15614VCF 100 µg

Ornithine Carbamoyltransferase (OTC) Mouse Monoclonal Antibody [Clone ID: LBI5A7]

Sign In for Pricing
View Details
Bleomycin Hydrolase (BLMH) Recombinant, Rat
153687-01 10 µg

Bleomycin Hydrolase (BLMH) Recombinant, Rat

Sign In for Pricing
View Details