Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 3-32 (LV332), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin lambda variable 3-32 (LV332), Biotinylated spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 3-32 IGLV3-32

UniProt

A0A0A0MS00

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SGPTQVPAVSVALGQMARITCQGDSMEGSYEHWYQQKPGQAPVLVIYDSSDRPSRIPERFSGSKSGNTTTLTITGAQAEDEADYYYQLIDNHATQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PP5 (protein phosphatase 5, catalytic subunit, FLJ36922, PP5, PPP5, PPT, PP-T, Protein phosphatase T, Serine/threonine-protein Phosphatase 5) (MaxLight 750)
MBS6495607-01 0.1 mL

PP5 (protein phosphatase 5, catalytic subunit, FLJ36922, PP5, PPP5, PPT, PP-T, Protein phosphatase T, Serine/threonine-protein Phosphatase 5) (MaxLight 750)

Sign In for Pricing
View Details
PP5 (protein phosphatase 5, catalytic subunit, FLJ36922, PP5, PPP5, PPT, PP-T, Protein phosphatase T, Serine/threonine-protein Phosphatase 5) (MaxLight 750)
MBS6495607-02 5x 0.1 mL

PP5 (protein phosphatase 5, catalytic subunit, FLJ36922, PP5, PPP5, PPT, PP-T, Protein phosphatase T, Serine/threonine-protein Phosphatase 5) (MaxLight 750)

Sign In for Pricing
View Details
Recombinant Human BTN2A1 Protein, C-His
MBS1578729-01 0.1 mg

Recombinant Human BTN2A1 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human BTN2A1 Protein, C-His
MBS1578729-02 1 mg

Recombinant Human BTN2A1 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human BTN2A1 Protein, C-His
MBS1578729-03 5x 1 mg

Recombinant Human BTN2A1 Protein, C-His

Sign In for Pricing
View Details
PITX3 Polyclonal Antibody
RD87284A-01 60 μL

PITX3 Polyclonal Antibody

Sign In for Pricing
View Details