Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 3-32 (LV332), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin lambda variable 3-32 (LV332), Biotinylated spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 3-32 IGLV3-32

UniProt

A0A0A0MS00

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SGPTQVPAVSVALGQMARITCQGDSMEGSYEHWYQQKPGQAPVLVIYDSSDRPSRIPERFSGSKSGNTTTLTITGAQAEDEADYYYQLIDNHATQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDCCAG3P1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV785571 1.0 µg DNA

SDCCAG3P1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Recombinant Epidermal Growth Factor
36001P 1 Each

Recombinant Epidermal Growth Factor

Sign In for Pricing
View Details
Cowingene Herpes Simplex Virus 1/2 Detection Kit
ST05012X 48 Tests/Kit

Cowingene Herpes Simplex Virus 1/2 Detection Kit

Sign In for Pricing
View Details
DNAAF4 Rabbit Polyclonal Antibody
orb330690 100 µL

DNAAF4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human SLC16A4 qPCR Primer Pair
QH27841S 200 Tests

Human SLC16A4 qPCR Primer Pair

Sign In for Pricing
View Details
Human UFC1 qPCR Primer Pair
QH41505S 200 Tests

Human UFC1 qPCR Primer Pair

Sign In for Pricing
View Details