Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 3-32 (LV332), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin lambda variable 3-32 (LV332), Biotinylated spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 3-32 IGLV3-32

UniProt

A0A0A0MS00

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SGPTQVPAVSVALGQMARITCQGDSMEGSYEHWYQQKPGQAPVLVIYDSSDRPSRIPERFSGSKSGNTTTLTITGAQAEDEADYYYQLIDNHATQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human cRAF-RBD with N-terminal His Tag
P2009-.02 20 µg

Human cRAF-RBD with N-terminal His Tag

Sign In for Pricing
View Details
COL20A1 Protein Lysate
OCOA08999-20UG 20 µg

COL20A1 Protein Lysate

Sign In for Pricing
View Details
Cardiac Troponin I (cTnI) Antibody
abx020869 1 mg

Cardiac Troponin I (cTnI) Antibody

Sign In for Pricing
View Details
Human DTYMK qPCR Primer Pair
QH13473S 200 Tests

Human DTYMK qPCR Primer Pair

Sign In for Pricing
View Details
Α-Ketoglutarate-dependent dioxygenase FTO (FTO) Mouse ELISA Kit
B4177 96 Tests

Α-Ketoglutarate-dependent dioxygenase FTO (FTO) Mouse ELISA Kit

Sign In for Pricing
View Details
PAK1/PAK2/PAK3 (Phospho-Thr423/Thr402/Thr421) Antibody
E011165-1 50 µg - 50 µL

PAK1/PAK2/PAK3 (Phospho-Thr423/Thr402/Thr421) Antibody

Sign In for Pricing
View Details