Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 5-3 (TVB53), Biotinylated

This Recombinant Human Probable non-functional T cell receptor beta variable 5-3 (TVB53), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 5-3 TRBV5-3

UniProt

A0A0A0MS03

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSPISGHSSVSWYQQAPGQGPQFIFEYANELRRSEGNFPNRFSGRQFHDYCSEMNVSALELGDSALYLCARSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFP36L2, ID (ZFP36L2, BRF2, ERF2, RNF162C, TIS11D, Zinc finger protein 36, C3H1 type-like 2, Butyrate response factor 2, EGF-response factor 2, Protein TIS11D) (MaxLight 650) discontinued
044063-ML650 100 µL

ZFP36L2, ID (ZFP36L2, BRF2, ERF2, RNF162C, TIS11D, Zinc finger protein 36, C3H1 type-like 2, Butyrate response factor 2, EGF-response factor 2, Protein TIS11D) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Human Sialic Acid Binding Ig Like Lectin 12 ELISA kit
GTR10430524 96 Well

Human Sialic Acid Binding Ig Like Lectin 12 ELISA kit

Sign In for Pricing
View Details
P2RX7, NT (P2X Purinoceptor 7, P2X7, ATP Receptor, P2Z Receptor, Purinergic Receptor)
MBS644383-01 0.05 mg

P2RX7, NT (P2X Purinoceptor 7, P2X7, ATP Receptor, P2Z Receptor, Purinergic Receptor)

Sign In for Pricing
View Details
P2RX7, NT (P2X Purinoceptor 7, P2X7, ATP Receptor, P2Z Receptor, Purinergic Receptor)
MBS644383-02 5x 0.05 mg

P2RX7, NT (P2X Purinoceptor 7, P2X7, ATP Receptor, P2Z Receptor, Purinergic Receptor)

Sign In for Pricing
View Details
Phospho-AQP2 (S256) Antibody
CSB-PA009580-01 50 µg

Phospho-AQP2 (S256) Antibody

Sign In for Pricing
View Details
Phospho-AQP2 (S256) Antibody
CSB-PA009580-02 100 µg

Phospho-AQP2 (S256) Antibody

Sign In for Pricing
View Details