Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 5-3 (TVB53), Biotinylated

This Recombinant Human Probable non-functional T cell receptor beta variable 5-3 (TVB53), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 5-3 TRBV5-3

UniProt

A0A0A0MS03

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSPISGHSSVSWYQQAPGQGPQFIFEYANELRRSEGNFPNRFSGRQFHDYCSEMNVSALELGDSALYLCARSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIH1 Domain Containing 1 Protein
abx262717-01 2 µg

PIH1 Domain Containing 1 Protein

Sign In for Pricing
View Details
PIH1 Domain Containing 1 Protein
abx262717-02 10 µg

PIH1 Domain Containing 1 Protein

Sign In for Pricing
View Details
PIH1 Domain Containing 1 Protein
abx262717-03 1 mg

PIH1 Domain Containing 1 Protein

Sign In for Pricing
View Details
Rabbit Polyclonal myosin X Antibody [DyLight 350]
NBP2-98105UV 0.1 mL

Rabbit Polyclonal myosin X Antibody [DyLight 350]

Sign In for Pricing
View Details
Samsn1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3845606 1.0 µg DNA

Samsn1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
RHOD antibody
MBS9407052-01 0.05 mL

RHOD antibody

Sign In for Pricing
View Details