Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 6-7 (TVB67), Biotinylated

This Recombinant Human Probable non-functional T cell receptor beta variable 6-7 (TVB67), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 6-7 TRBV6-7

UniProt

A0A0A0MS04

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHVLKTGQSMTLLCAQDMNHEYMYRYRQDPGKGLRLIYYSVAAALTDKGEVPNGYNVSRSNTEDFPLKLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1448), CF405S conjugate, 0.1mg/mL
BNC041448-100 1x 100 µL

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1448), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLK3 (NM_004073) Human Over-expression Lysate
LY418239 100 µg

PLK3 (NM_004073) Human Over-expression Lysate

Sign In for Pricing
View Details
RFC4 (NM_002916) Human Over-expression Lysate
LY419019 100 µg

RFC4 (NM_002916) Human Over-expression Lysate

Sign In for Pricing
View Details
Uncoated Human IL17RA (Interleukin-17 receptor A) ELISA Kit
E-UNEL-H0262-01 5x 96 Tests

Uncoated Human IL17RA (Interleukin-17 receptor A) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human IL17RA (Interleukin-17 receptor A) ELISA Kit
E-UNEL-H0262-02 15x 96 Tests

Uncoated Human IL17RA (Interleukin-17 receptor A) ELISA Kit

Sign In for Pricing
View Details
4-Biphenylyl Glucuronide
TRC-B397905-25MG 25 mg

4-Biphenylyl Glucuronide

Sign In for Pricing
View Details