Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 6-7 (TVB67), Biotinylated

This Recombinant Human Probable non-functional T cell receptor beta variable 6-7 (TVB67), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 6-7 TRBV6-7

UniProt

A0A0A0MS04

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHVLKTGQSMTLLCAQDMNHEYMYRYRQDPGKGLRLIYYSVAAALTDKGEVPNGYNVSRSNTEDFPLKLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zinc Sulfate Monohydrate
TRC-Z766490-5G 5 g

Zinc Sulfate Monohydrate

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS712564 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Nefl Rabbit Monoclonal Antibody [Clone ID: R04-7H3]
TA421561 100 µL

Nefl Rabbit Monoclonal Antibody [Clone ID: R04-7H3]

Sign In for Pricing
View Details
TLR3 (C-term) Rabbit Polyclonal Antibody
AP22865PU-N 50 µg

TLR3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Superoxide Dismutase 1 (SOD1) (Antioxidant Enzyme) (SOD1/2089), CF594 conjugate, 0.1mg/mL
BNC942089-100 1x 100 µL

Superoxide Dismutase 1 (SOD1) (Antioxidant Enzyme) (SOD1/2089), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Disperse Orange 37
TRC-D493490-500MG 500 mg

Disperse Orange 37

Sign In for Pricing
View Details