Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 6-7 (TVB67), Biotinylated

This Recombinant Human Probable non-functional T cell receptor beta variable 6-7 (TVB67), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 6-7 TRBV6-7

UniProt

A0A0A0MS04

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHVLKTGQSMTLLCAQDMNHEYMYRYRQDPGKGLRLIYYSVAAALTDKGEVPNGYNVSRSNTEDFPLKLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM238 (NM_001190764) Human Over-expression Lysate
LY434016 100 µg

TMEM238 (NM_001190764) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A11]
TA500214BM 100 µL

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A11]

Sign In for Pricing
View Details
GOLPH2 (GOLM1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F3]
TA504115BM 100 µL

GOLPH2 (GOLM1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F3]

Sign In for Pricing
View Details
2-Naphthylacetic Acid
TRC-N368490-25G 25 g

2-Naphthylacetic Acid

Sign In for Pricing
View Details
OptiWell™ Deep Well Plates
D3096-39 50 Units/Case

OptiWell™ Deep Well Plates

Sign In for Pricing
View Details
P53 Recombinant Mouse monoclonal Antibody
HA610187 100 µg

P53 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details