Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 6-7 (TVB67), Biotinylated

This Recombinant Human Probable non-functional T cell receptor beta variable 6-7 (TVB67), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 6-7 TRBV6-7

UniProt

A0A0A0MS04

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHVLKTGQSMTLLCAQDMNHEYMYRYRQDPGKGLRLIYYSVAAALTDKGEVPNGYNVSRSNTEDFPLKLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKKB, Phosphorylated (S705) (IKBKB, IKKB, Inhibitor of nuclear factor kappa-B kinase subunit beta, I-kappa-B kinase 2, Nuclear factor NF-kappa-B inhibitor kinase beta) (Biotin)
MBS6309774-01 0.2 mL

IKKB, Phosphorylated (S705) (IKBKB, IKKB, Inhibitor of nuclear factor kappa-B kinase subunit beta, I-kappa-B kinase 2, Nuclear factor NF-kappa-B inhibitor kinase beta) (Biotin)

Sign In for Pricing
View Details
IKKB, Phosphorylated (S705) (IKBKB, IKKB, Inhibitor of nuclear factor kappa-B kinase subunit beta, I-kappa-B kinase 2, Nuclear factor NF-kappa-B inhibitor kinase beta) (Biotin)
MBS6309774-02 5x 0.2 mL

IKKB, Phosphorylated (S705) (IKBKB, IKKB, Inhibitor of nuclear factor kappa-B kinase subunit beta, I-kappa-B kinase 2, Nuclear factor NF-kappa-B inhibitor kinase beta) (Biotin)

Sign In for Pricing
View Details
Phospho-PDPK1 (Tyr9) Rabbit Polyclonal Antibody (PE-Cy7)
orb895189 100 µL

Phospho-PDPK1 (Tyr9) Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Human Adipose-derived Mesenchymal Stem Cell Complete Medium
CM-H202-01 100 mL

Human Adipose-derived Mesenchymal Stem Cell Complete Medium

Sign In for Pricing
View Details
Human Adipose-derived Mesenchymal Stem Cell Complete Medium
CM-H202-02 4x 125 mL

Human Adipose-derived Mesenchymal Stem Cell Complete Medium

Sign In for Pricing
View Details
Olfr729 Lentiviral Activation Particles (m)
sc-434435-LAC 200 µL

Olfr729 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details