Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 23-1 (TVB23), Biotinylated

This Recombinant Human Probable non-functional T cell receptor beta variable 23-1 (TVB23), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 23-1 TRBV23-1

UniProt

A0A0A0MS06

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KVTQTPGHLVKGKGQKTKMDCTPEKGHTFVYWYQQNQNKEFMLLISFQNEQVLQETEMHKKRFSSQCPKNAPCSLAILSSEPGDTALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATR Antibody Blocking peptide
orb1445501 500 µg

ATR Antibody Blocking peptide

Sign In for Pricing
View Details
Human MIP18 family protein FAM96A (FAM96A) Elisa Kit
EK712354 96 Well

Human MIP18 family protein FAM96A (FAM96A) Elisa Kit

Sign In for Pricing
View Details
TMEM132B Protein Vector (Human) (pPM-C-HA)
46888021 500 ng

TMEM132B Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Fabp3 (Fatty acid-binding protein, heart) BioAssayTM ELISA Kit (Mouse) discontinued
355554-01 48 Tests

Fabp3 (Fatty acid-binding protein, heart) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
Fabp3 (Fatty acid-binding protein, heart) BioAssayTM ELISA Kit (Mouse) discontinued
355554-02 96 Tests

Fabp3 (Fatty acid-binding protein, heart) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
Dickkopf-Related Protein 1 (DKK1) Antibody
abx405358-01 100 µL

Dickkopf-Related Protein 1 (DKK1) Antibody

Sign In for Pricing
View Details