Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 23-1 (TVB23), Biotinylated

This Recombinant Human Probable non-functional T cell receptor beta variable 23-1 (TVB23), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 23-1 TRBV23-1

UniProt

A0A0A0MS06

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KVTQTPGHLVKGKGQKTKMDCTPEKGHTFVYWYQQNQNKEFMLLISFQNEQVLQETEMHKKRFSSQCPKNAPCSLAILSSEPGDTALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Prkx Pre-designed siRNA Set A
SI211094A 1 Each

Rat Prkx Pre-designed siRNA Set A

Sign In for Pricing
View Details
Integrin alpha 2B (ITGA2B, GT, GTA, CD41, GP2B, HPA3, CD41B, GPIIb, BDPLT2, BDPLT16) (MaxLight 550)
MBS6422895-01 0.1 mL

Integrin alpha 2B (ITGA2B, GT, GTA, CD41, GP2B, HPA3, CD41B, GPIIb, BDPLT2, BDPLT16) (MaxLight 550)

Sign In for Pricing
View Details
Integrin alpha 2B (ITGA2B, GT, GTA, CD41, GP2B, HPA3, CD41B, GPIIb, BDPLT2, BDPLT16) (MaxLight 550)
MBS6422895-02 5x 0.1 mL

Integrin alpha 2B (ITGA2B, GT, GTA, CD41, GP2B, HPA3, CD41B, GPIIb, BDPLT2, BDPLT16) (MaxLight 550)

Sign In for Pricing
View Details
Anti-COX17  (1A9)
YF-MA17101 100 ug

Anti-COX17 (1A9)

Sign In for Pricing
View Details
1- (ethylsulfonyl) piperidine-2-carboxylic acid
sc-345104A 5 g

1- (ethylsulfonyl) piperidine-2-carboxylic acid

Sign In for Pricing
View Details
Ryk (NM_080402) Rat Untagged Clone
RN211807 10 µg

Ryk (NM_080402) Rat Untagged Clone

Sign In for Pricing
View Details