Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-49 (HV349), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-49 (HV349), Biotinylated spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-49 IGHV3-49

UniProt

A0A0A0MS15

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGRSLRLSCTASGFTFGDYAMSWVRQAPGKGLEWVGFIRSKAYGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibin beta A (INHBA) (NM_002192) Human Over-expression Lysate
LY400796 100 µg

Inhibin beta A (INHBA) (NM_002192) Human Over-expression Lysate

Sign In for Pricing
View Details
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1945), CF568 conjugate, 0.1mg/mL
BNC681945-100 1x 100 µL

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1945), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Chloro-3-hydrazinylpyrazine
TRC-C367643-1G 1 g

2-Chloro-3-hydrazinylpyrazine

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse IL-6 Antibody[MP5-20F3]
E-AB-F1207M1-01 50 Tests

Elab Fluor® 700 Anti-Mouse IL-6 Antibody[MP5-20F3]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse IL-6 Antibody[MP5-20F3]
E-AB-F1207M1-02 100 Tests

Elab Fluor® 700 Anti-Mouse IL-6 Antibody[MP5-20F3]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse IL-6 Antibody[MP5-20F3]
E-AB-F1207M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Mouse IL-6 Antibody[MP5-20F3]

Sign In for Pricing
View Details