Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 6D-21 (KVD21), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 6D-21 (KVD21), Biotinylated spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 6D-21 IGKV6D-21

UniProt

A0A0A0MT36

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPDFQSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAAAYYCHQSSSLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C17orf59 siRNA (Human)
CRJ0215-01 15 nmol

C17orf59 siRNA (Human)

Sign In for Pricing
View Details
C17orf59 siRNA (Human)
CRJ0215-02 30 nmol

C17orf59 siRNA (Human)

Sign In for Pricing
View Details
Human SGSM1 qPCR Primer Pair
QH62173S 200 Tests

Human SGSM1 qPCR Primer Pair

Sign In for Pricing
View Details
Mouse HIPK2 shRNA Plasmid
abx970806-01 150 µg

Mouse HIPK2 shRNA Plasmid

Sign In for Pricing
View Details
Mouse HIPK2 shRNA Plasmid
abx970806-02 300 µg

Mouse HIPK2 shRNA Plasmid

Sign In for Pricing
View Details
Pentaerythritol distearate (mixture)
orb2939880-01 25 g

Pentaerythritol distearate (mixture)

Sign In for Pricing
View Details