Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 13 (TVB13), Biotinylated

This Recombinant Human T cell receptor beta variable 13 (TVB13), Biotinylated spans the amino acid sequence from region 32-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 13 TRBV13

UniProt

A0A0A6YYD4

Expression Region

32-124

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIQSPRHLIKEKRETATLKCYPIPRHDTVYWYQQGPGQDPQFLISFYEKMQSDKGSIPDRFSAQQFSDYHSELNMSSLELGDSALYFCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epha1, ID (Epha1, Esk, Ephrin type-A receptor 1, Embryonic stem cell kinase, Tyrosine-protein kinase receptor ESK) (PE)
MBS6295962-01 0.2 mL

Epha1, ID (Epha1, Esk, Ephrin type-A receptor 1, Embryonic stem cell kinase, Tyrosine-protein kinase receptor ESK) (PE)

Sign In for Pricing
View Details
Epha1, ID (Epha1, Esk, Ephrin type-A receptor 1, Embryonic stem cell kinase, Tyrosine-protein kinase receptor ESK) (PE)
MBS6295962-02 5x 0.2 mL

Epha1, ID (Epha1, Esk, Ephrin type-A receptor 1, Embryonic stem cell kinase, Tyrosine-protein kinase receptor ESK) (PE)

Sign In for Pricing
View Details
SLC38A4 Antibody
C49380-01 40 µL

SLC38A4 Antibody

Sign In for Pricing
View Details
SLC38A4 Antibody
C49380-02 100 µL

SLC38A4 Antibody

Sign In for Pricing
View Details
SLC38A4 Antibody
C49380-03 200 µL

SLC38A4 Antibody

Sign In for Pricing
View Details
PA200 Lentiviral Activation Particles (h2)
sc-404513-LAC-2 200 µL

PA200 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details