Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-6 (TVB66), Biotinylated

This Recombinant Human T cell receptor beta variable 6-6 (TVB66), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-6 TRBV6-6

UniProt

A0A0A6YYG2

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRILKIGQSMTLQCAQDMNHNYMYWYRQDPGMGLKLIYYSVGAGITDKGEVPNGYNVSRSTTEDFPLRLELAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IREB2 Rabbit Polyclonal Antibody
R1706-12 100 µL

IREB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C6orf206 (RSPH9) (NM_001193341) Human Over-expression Lysate
LC434150 20 µg

C6orf206 (RSPH9) (NM_001193341) Human Over-expression Lysate

Sign In for Pricing
View Details
CD8 (C8/468), CF568 conjugate, 0.1mg/mL
BNC680468-500 1x 500 µL

CD8 (C8/468), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RAF1 pSer296 Rabbit Polyclonal Antibody
AP12748PU-N 400 µL

RAF1 pSer296 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ERLIN1 Rabbit Polyclonal Antibody
TA366504 100 µL

ERLIN1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant EPN3 Antibody
RN-17144-01 50 μL

Recombinant EPN3 Antibody

Sign In for Pricing
View Details