Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-8 (TVB68), Biotinylated

This Recombinant Human T cell receptor beta variable 6-8 (TVB68), Biotinylated spans the amino acid sequence from region 22-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-8 TRBV6-8

UniProt

A0A0A6YYG3

Expression Region

22-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHILKTGQSMTLQCAQDMNHGYMSWYRQDPGMGLRLIYYSAAAGTTDKEVPNGYNVSRLNTEDFPLRLVSAAPSQTSVYLCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSD11B1L (NM_198533) Human Untagged Clone
SC127883 10 µg

HSD11B1L (NM_198533) Human Untagged Clone

Sign In for Pricing
View Details
Bovine Interleukin-8 ELISA Kit
MBS9425094-01 96 Tests

Bovine Interleukin-8 ELISA Kit

Sign In for Pricing
View Details
Bovine Interleukin-8 ELISA Kit
MBS9425094-02 5x 96 Tests

Bovine Interleukin-8 ELISA Kit

Sign In for Pricing
View Details
TLR2 Antibody
orb1238763-01 0.02 mg

TLR2 Antibody

Sign In for Pricing
View Details
TLR2 Antibody
orb1238763-02 0.1 mg

TLR2 Antibody

Sign In for Pricing
View Details
Anti-CEACAM1/3/5/6/8 Antibody (6G5j)
HY-P990854 1 Each

Anti-CEACAM1/3/5/6/8 Antibody (6G5j)

Sign In for Pricing
View Details