Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-8 (TVB68), Biotinylated

This Recombinant Human T cell receptor beta variable 6-8 (TVB68), Biotinylated spans the amino acid sequence from region 22-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-8 TRBV6-8

UniProt

A0A0A6YYG3

Expression Region

22-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHILKTGQSMTLQCAQDMNHGYMSWYRQDPGMGLRLIYYSAAAGTTDKEVPNGYNVSRLNTEDFPLRLVSAAPSQTSVYLCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-mmu-miR-6907-3p Vector
mm41538 500 ng

LentimiRa-mmu-miR-6907-3p Vector

Sign In for Pricing
View Details
Pla2g12a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4126208 1.0 µg DNA

Pla2g12a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Noelin (OLFM1) (NM_006334) Human Tagged ORF Clone Lentiviral Particle
RC224545L3V 200 µL

Noelin (OLFM1) (NM_006334) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PARK7/DJ1 Antibody (YA1799, Rabbit)
HY-P82054-01 10 µL

PARK7/DJ1 Antibody (YA1799, Rabbit)

Sign In for Pricing
View Details
PARK7/DJ1 Antibody (YA1799, Rabbit)
HY-P82054-02 50 μL

PARK7/DJ1 Antibody (YA1799, Rabbit)

Sign In for Pricing
View Details
PARK7/DJ1 Antibody (YA1799, Rabbit)
HY-P82054-03 100 µL

PARK7/DJ1 Antibody (YA1799, Rabbit)

Sign In for Pricing
View Details