Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-3 (TVA83), Biotinylated

This Recombinant Human T cell receptor alpha variable 8-3 (TVA83), Biotinylated spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-3 TRAV8-3

UniProt

A0A0A6YYJ7

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVTQPDIHITVSEGASLELRCNYSYGATPYLFWYVQSPGQGLQLLLKYFSGDTLVQGIKGFEAEFKRSQSSFNLRKPSVHWSDAAEYFCAVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM38A (G-12) Alexa Fluor® 488
sc-390054 AF488 200 µg/mL

TMEM38A (G-12) Alexa Fluor® 488

Sign In for Pricing
View Details
Lomtegovimab Biosimilar - Research Grade
ICH5654-20mg 20 mg

Lomtegovimab Biosimilar - Research Grade

Sign In for Pricing
View Details
Rat UD16 ELISA Kit
E106393 1 Each

Rat UD16 ELISA Kit

Sign In for Pricing
View Details
Nori® Human Apelin-17 ELISA Kit
GR111151 96 Well

Nori® Human Apelin-17 ELISA Kit

Sign In for Pricing
View Details
Glutamine synthetase
orb1641484-01 50 µg

Glutamine synthetase

Sign In for Pricing
View Details
Glutamine synthetase
orb1641484-02 100 µg

Glutamine synthetase

Sign In for Pricing
View Details