Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-1 (TVA81), Biotinylated

This Recombinant Human T cell receptor alpha variable 8-1 (TVA81), Biotinylated spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-1 TRAV8-1

UniProt

A0A0A6YYK1

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVSQHNHHVILSEAASLELGCNYSYGGTVNLFWYVQYPGQHLQLLLKYFSGDPLVKGIKGFEAEFIKSKFSFNLRKPSVQWSDTAEYFCAVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL5A (NM_012097) Human Over-expression Lysate
LY415981 100 µg

ARL5A (NM_012097) Human Over-expression Lysate

Sign In for Pricing
View Details
Human GGPS1 Pre-designed siRNA Set B
SI006212B 1 Each

Human GGPS1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Microcolin B
HY-130999 5 mg

Microcolin B

Sign In for Pricing
View Details
NTR3 Polyclonal Antibody, Biotin Conjugated
bs-6329R-Biotin 100 µL

NTR3 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
CYP2E1 Antibody / Cytochrome P450
V3742-20UG 20 µg

CYP2E1 Antibody / Cytochrome P450

Sign In for Pricing
View Details
Human TP53 (Tumor Protein p53) ELISA Kit
RE1507H-01 48 Tests

Human TP53 (Tumor Protein p53) ELISA Kit

Sign In for Pricing
View Details