Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 7-1 (TVB71), Biotinylated

This Recombinant Human Probable non-functional T cell receptor beta variable 7-1 (TVB71), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 7-1 TRBV7-1

UniProt

A0A0A6YYK4

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSLRHKVAKKGKDVALRYDPISGHNALYWYRQSLGQGLEFPIYFQGKDAADKSGLPRDRFSAQRSEGSISTLKFQRTQQGDLAVYLCASSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Arylsulfatase A (ARSA) ELISA kit
GTR10386135 96 Well

Monkey Arylsulfatase A (ARSA) ELISA kit

Sign In for Pricing
View Details
Recombinant human FGF-8b protein
ATGP4097-250 250 µg

Recombinant human FGF-8b protein

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-3/IL-3 Protein (C-6His)
MBS2553560-01 0.01 mg

Recombinant Mouse Interleukin-3/IL-3 Protein (C-6His)

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-3/IL-3 Protein (C-6His)
MBS2553560-02 0.05 mg

Recombinant Mouse Interleukin-3/IL-3 Protein (C-6His)

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-3/IL-3 Protein (C-6His)
MBS2553560-03 5x 0.05 mg

Recombinant Mouse Interleukin-3/IL-3 Protein (C-6His)

Sign In for Pricing
View Details
ACAS2 Rabbit Polyclonal Antibody
orb377893-01 30 µL

ACAS2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details