Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 7-1 (TVB71), Biotinylated

This Recombinant Human Probable non-functional T cell receptor beta variable 7-1 (TVB71), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 7-1 TRBV7-1

UniProt

A0A0A6YYK4

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSLRHKVAKKGKDVALRYDPISGHNALYWYRQSLGQGLEFPIYFQGKDAADKSGLPRDRFSAQRSEGSISTLKFQRTQQGDLAVYLCASSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cycloastragenol
163231 100 mg

Cycloastragenol

Sign In for Pricing
View Details
Chicken Polyclonal Adenylate Cyclase 3 Antibody [HRP]
NBP3-05527H 0.1 mL

Chicken Polyclonal Adenylate Cyclase 3 Antibody [HRP]

Sign In for Pricing
View Details
C16orf85-set siRNA/shRNA/RNAi Lentivector (Human)
13946091 4x 500 ng

C16orf85-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
FZD1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0825308 1.0 µg DNA

FZD1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Brox sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7173607 1.0 µg DNA

Brox sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
HBG1 Antibody, FITC conjugated
A24402-100UG 100 µg

HBG1 Antibody, FITC conjugated

Sign In for Pricing
View Details