Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 16 (TVA16), Biotinylated

This Recombinant Human T cell receptor alpha variable 16 (TVA16), Biotinylated spans the amino acid sequence from region 21-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 16 TRAV16

UniProt

A0A0A6YYK6

Expression Region

21-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QRVTQPEKLLSVFKGAPVELKCNYSYSGSPELFWYVQYSRQRLQLLLRHISRESIKGFTADLNKGETSFHLKKPFAQEEDSAMYYCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cldn9 Mouse Gene Knockout Kit (CRISPR)
KN503424 1 Kit

Cldn9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GALR1 (NM_001480) Human Over-expression Lysate
LC419921 20 µg

GALR1 (NM_001480) Human Over-expression Lysate

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (SOX9/2398), 1mg/mL
BNUM2398-50 1x 50 µL

SOX9 / SRY-box 9 (SOX9/2398), 1mg/mL

Sign In for Pricing
View Details
BTNL8 (NM_001159708) Human Over-expression Lysate
LC431298 20 µg

BTNL8 (NM_001159708) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse KIM-1 Antibody Pair Set
E-KAB-0086 50 µL & 100 µg

Mouse KIM-1 Antibody Pair Set

Sign In for Pricing
View Details
2-Nitro-N1-phenylbenzene-1,4-diamine
TRC-N232720-2.5G 2.5 g

2-Nitro-N1-phenylbenzene-1,4-diamine

Sign In for Pricing
View Details