Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 16 (TVA16), Biotinylated

This Recombinant Human T cell receptor alpha variable 16 (TVA16), Biotinylated spans the amino acid sequence from region 21-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 16 TRAV16

UniProt

A0A0A6YYK6

Expression Region

21-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QRVTQPEKLLSVFKGAPVELKCNYSYSGSPELFWYVQYSRQRLQLLLRHISRESIKGFTADLNKGETSFHLKKPFAQEEDSAMYYCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dinotefuran DN Hydrochloride
TRC-D484610-50MG 50 mg

Dinotefuran DN Hydrochloride

Sign In for Pricing
View Details
Human FASTKD5 activation kit by CRISPRa
GA111860 1 Kit

Human FASTKD5 activation kit by CRISPRa

Sign In for Pricing
View Details
TCP11L2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A10]
TA501802AM 100 µL

TCP11L2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A10]

Sign In for Pricing
View Details
Human IRX4 activation kit by CRISPRa
GA109449 1 Kit

Human IRX4 activation kit by CRISPRa

Sign In for Pricing
View Details
Glycyl-l-alanine
TRC-G720113-250MG 250 mg

Glycyl-l-alanine

Sign In for Pricing
View Details
Lucatumumab Biosimilar - Research Grade
ICH5129-20mg 20 mg

Lucatumumab Biosimilar - Research Grade

Sign In for Pricing
View Details