Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 16 (TVA16), Biotinylated

This Recombinant Human T cell receptor alpha variable 16 (TVA16), Biotinylated spans the amino acid sequence from region 21-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 16 TRAV16

UniProt

A0A0A6YYK6

Expression Region

21-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QRVTQPEKLLSVFKGAPVELKCNYSYSGSPELFWYVQYSRQRLQLLLRHISRESIKGFTADLNKGETSFHLKKPFAQEEDSAMYYCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Ovary: left
CS807900 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details
CTPS Recombinant Rabbit Monoclonal Antibody [JE63-85]
HA721003 100 µL

CTPS Recombinant Rabbit Monoclonal Antibody [JE63-85]

Sign In for Pricing
View Details
Uncoated Human CA9 (Carbonic Anhydrase IX) ELISA Kit
E-UNEL-H0332-01 5x 96 Tests

Uncoated Human CA9 (Carbonic Anhydrase IX) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human CA9 (Carbonic Anhydrase IX) ELISA Kit
E-UNEL-H0332-02 15x 96 Tests

Uncoated Human CA9 (Carbonic Anhydrase IX) ELISA Kit

Sign In for Pricing
View Details
Comp Mouse Gene Knockout Kit (CRISPR)
KN503672 1 Kit

Comp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CISD2 Rabbit Polyclonal Antibody
TA374813 100 µL

CISD2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details