Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 16 (TVA16), Biotinylated

This Recombinant Human T cell receptor alpha variable 16 (TVA16), Biotinylated spans the amino acid sequence from region 21-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 16 TRAV16

UniProt

A0A0A6YYK6

Expression Region

21-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QRVTQPEKLLSVFKGAPVELKCNYSYSGSPELFWYVQYSRQRLQLLLRHISRESIKGFTADLNKGETSFHLKKPFAQEEDSAMYYCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,3,8-triazaspiro[4.5]decane-2,4-dione
sc-273614 250 mg

1,3,8-triazaspiro[4.5]decane-2,4-dione

Sign In for Pricing
View Details
IR415
BA1830-25 25 mg

IR415

Sign In for Pricing
View Details
PTPN1/2 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-62527R-BF555 100 µL

PTPN1/2 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal TIGAR/C12orf5 Antibody [mFluor Violet 610 SE]
NBP1-49534MFV610 0.1 mL

Rabbit Polyclonal TIGAR/C12orf5 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
PAK2 (Ab-141) Antibody
E033243 100 µg -100 µL

PAK2 (Ab-141) Antibody

Sign In for Pricing
View Details
Pentraxin 3 (PTX3) Antibody
abx173974-01 100 µL

Pentraxin 3 (PTX3) Antibody

Sign In for Pricing
View Details