Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 19 (TVA19), Biotinylated

This Recombinant Human T cell receptor alpha variable 19 (TVA19), Biotinylated spans the amino acid sequence from region 22-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 19; T-cell receptor alpha chain V region HPB-MLT; TRAV19

UniProt

A0A0A6YYK7

Expression Region

22-116

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKVTQAQTEISVVEKEDVTLDCVYETRDTTYYLFWYKQPPSGELVFLIRRNSFDEQNEISGRYSWNFQKSTSSFNFTITASQVVDSAVYFCALSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Farnesol (Mixture of Isomers)
TRC-F102455-50G 50 g

Farnesol (Mixture of Isomers)

Sign In for Pricing
View Details
8H9 Biosimilar - Research Grade
ICH5118-20mg 20 mg

8H9 Biosimilar - Research Grade

Sign In for Pricing
View Details
CD84 (NM_003874) Human Over-expression Lysate
LC401277 20 µg

CD84 (NM_003874) Human Over-expression Lysate

Sign In for Pricing
View Details
Mt1 (NM_013602) Mouse Tagged ORF Clone
MG200036 10 µg

Mt1 (NM_013602) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
[1,4'-Bipiperidine]-4'-carboxamide Dihydrochloride
TRC-B399405-2.5MG 2.5 mg

[1,4'-Bipiperidine]-4'-carboxamide Dihydrochloride

Sign In for Pricing
View Details
Tide Quencher™ 5.1WS azide [TQ5.1WS azide]
2088-AAT 1 mg

Tide Quencher™ 5.1WS azide [TQ5.1WS azide]

Sign In for Pricing
View Details