Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 1-36 (LV136), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 1-36 (LV136), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 1-36 IGLV1-36

UniProt

A0A0B4J1U3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVLTQPPSVSEAPRQRVTISCSGSSSNIGNNAVNWYQQLPGKAPKLLIYYDDLLPSGVSDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTMR14 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV712532 1.0 µg DNA

MTMR14 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Human UCK (UCK1) activation kit by CRISPRa
GA113199 1 Kit

Human UCK (UCK1) activation kit by CRISPRa

Sign In for Pricing
View Details
Rabbit Monoclonal ACBD7 Antibody (005) [Biotin]
NBP2-90286B 0.1 mL

Rabbit Monoclonal ACBD7 Antibody (005) [Biotin]

Sign In for Pricing
View Details
Recombinant Otolemur garnettii Septin-8 (SEPT8)
MBS1105385-01 0.02 mg (E-Coli)

Recombinant Otolemur garnettii Septin-8 (SEPT8)

Sign In for Pricing
View Details
Recombinant Otolemur garnettii Septin-8 (SEPT8)
MBS1105385-02 0.02 mg (Yeast)

Recombinant Otolemur garnettii Septin-8 (SEPT8)

Sign In for Pricing
View Details
Recombinant Otolemur garnettii Septin-8 (SEPT8)
MBS1105385-03 0.1 mg (E-Coli)

Recombinant Otolemur garnettii Septin-8 (SEPT8)

Sign In for Pricing
View Details