Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 6-1 (HV601), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 6-1 (HV601), Biotinylated spans the amino acid sequence from region 21-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 6-1 IGHV6-1

UniProt

A0A0B4J1U7

Expression Region

21-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNWIRQSPSRGLEWLGRTYYRSKWYNDYAVSVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MATN3 polyclonal antibody
orb647047-01 50 μL

MATN3 polyclonal antibody

Sign In for Pricing
View Details
MATN3 polyclonal antibody
orb647047-02 100 µL

MATN3 polyclonal antibody

Sign In for Pricing
View Details
MATN3 polyclonal antibody
orb647047-03 200 µL

MATN3 polyclonal antibody

Sign In for Pricing
View Details
Nhlh1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6630902 1.0 µg DNA

Nhlh1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Human BaculoViral IAP Repeat Containing Protein 6 ELISA Kit
MBS051625-01 48 Well

Human BaculoViral IAP Repeat Containing Protein 6 ELISA Kit

Sign In for Pricing
View Details
Human BaculoViral IAP Repeat Containing Protein 6 ELISA Kit
MBS051625-02 96 Well

Human BaculoViral IAP Repeat Containing Protein 6 ELISA Kit

Sign In for Pricing
View Details