Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 6-1 (HV601), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 6-1 (HV601), Biotinylated spans the amino acid sequence from region 21-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 6-1 IGHV6-1

UniProt

A0A0B4J1U7

Expression Region

21-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNWIRQSPSRGLEWLGRTYYRSKWYNDYAVSVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-DcR2/TRAIL R4 Antibody (5W924)
TMAY-00787 100 µL

Anti-DcR2/TRAIL R4 Antibody (5W924)

Sign In for Pricing
View Details
Chrm1 3'UTR Lenti-reporter-Luc Vector
16113086 1.0 µg

Chrm1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Human SSRP1 siRNA
abx905295-01 15 nmol

Human SSRP1 siRNA

Sign In for Pricing
View Details
Human SSRP1 siRNA
abx905295-02 30 nmol

Human SSRP1 siRNA

Sign In for Pricing
View Details
Recombinant Clostridium Cellulolyticum atpG Protein (aa 1-294)
VAng-Lsx8879-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Cellulolyticum atpG Protein (aa 1-294)

Sign In for Pricing
View Details
FastGreen Q-PCR Master Mix, No Rox
Q7000-005 5x 1 mL

FastGreen Q-PCR Master Mix, No Rox

Sign In for Pricing
View Details