Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-15 (HV315), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-15 (HV315), Biotinylated spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-15 IGHV3-15

UniProt

A0A0B4J1V0

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVGRIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DSPP Rabbit Polyclonal Antibody (N-term)
E28PB1735 100 µL

DSPP Rabbit Polyclonal Antibody (N-term)

Sign In for Pricing
View Details
1,7-Bis (4-hydroxyphenyl) -5-hydroxyhept-1-en-3-one
orb1680985 5 mg

1,7-Bis (4-hydroxyphenyl) -5-hydroxyhept-1-en-3-one

Sign In for Pricing
View Details
2-​Amino-​6-​chloro-​4-​pyrimidinol
415331-01 250 mg

2-​Amino-​6-​chloro-​4-​pyrimidinol

Sign In for Pricing
View Details
2-​Amino-​6-​chloro-​4-​pyrimidinol
415331-02 1 g

2-​Amino-​6-​chloro-​4-​pyrimidinol

Sign In for Pricing
View Details
Goat Anti-Pig IgG (H&L) - Alexa Fluor 647
E51S3810 100 µL

Goat Anti-Pig IgG (H&L) - Alexa Fluor 647

Sign In for Pricing
View Details
Rpl5 (BC026934) Mouse Tagged Lenti ORF Clone
MR204113L4 10 µg

Rpl5 (BC026934) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details