Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-21 (HV321), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-21 (HV321), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-21 IGHV3-21

UniProt

A0A0B4J1V1

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-NMMA, pan-specific NOS inhibitor
TBI2884-50MG 50 mg

L-NMMA, pan-specific NOS inhibitor

Sign In for Pricing
View Details
Recombinant Campylobacter lari DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1103268-01 0.02 mg (E-Coli)

Recombinant Campylobacter lari DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Campylobacter lari DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1103268-02 0.1 mg (E-Coli)

Recombinant Campylobacter lari DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Campylobacter lari DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1103268-03 0.02 mg (Yeast)

Recombinant Campylobacter lari DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Campylobacter lari DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1103268-04 0.1 mg (Yeast)

Recombinant Campylobacter lari DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Campylobacter lari DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1103268-05 0.02 mg (Baculovirus)

Recombinant Campylobacter lari DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details