Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-21 (HV321), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-21 (HV321), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-21 IGHV3-21

UniProt

A0A0B4J1V1

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUT Recombinant Antibody, Cy5 Conjugated
bsm-62811R-Cy5-TR 20 µL

DUT Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain YJM789)(Baker's yeast) MDM10 Polyclonal Antibody
MBS7168401 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain YJM789)(Baker's yeast) MDM10 Polyclonal Antibody

Sign In for Pricing
View Details
ANKFY1 Lentiviral Activation Particles (m2)
sc-419110-LAC-2 200 µL

ANKFY1 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Ceruloplasmin Light Tryptic Peptide Standard (4nmol)
BP17-660 4 Piece

Ceruloplasmin Light Tryptic Peptide Standard (4nmol)

Sign In for Pricing
View Details
HMGB4 Antibody - C-terminal region
ARP39852_P050-25UL 25 µL

HMGB4 Antibody - C-terminal region

Sign In for Pricing
View Details
[5- (3,4-dihydroisoquinolin-2 (1H) -ylsulfonyl) thien-2-yl]acetic acid
sc-349950 250 mg

[5- (3,4-dihydroisoquinolin-2 (1H) -ylsulfonyl) thien-2-yl]acetic acid

Sign In for Pricing
View Details