Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-21 (HV321), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-21 (HV321), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-21 IGHV3-21

UniProt

A0A0B4J1V1

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CREG2 shRNA Plasmid
abx966249-01 150 µg

Human CREG2 shRNA Plasmid

Sign In for Pricing
View Details
Human CREG2 shRNA Plasmid
abx966249-02 300 µg

Human CREG2 shRNA Plasmid

Sign In for Pricing
View Details
Angpt2 Polyclonal Antibody, FITC Conjugated
A52514-100 100 µL

Angpt2 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Dnajb7 Mouse shRNA Lentiviral Particle (Locus ID 57755)
TL503328V 500 µL Each

Dnajb7 Mouse shRNA Lentiviral Particle (Locus ID 57755)

Sign In for Pricing
View Details
Rabbit Polyclonal Stathmin 1 Antibody [FITC]
NBP2-99433F 0.1 mL

Rabbit Polyclonal Stathmin 1 Antibody [FITC]

Sign In for Pricing
View Details
MCUF-651
MBS5810322 Inquire

MCUF-651

Sign In for Pricing
View Details