Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 2-26 (HV226), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 2-26 (HV226), Biotinylated spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 2-26 IGHV2-26

UniProt

A0A0B4J1V2

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTLKESGPVLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ferroceneacetic Acid
TRC-F307605-1G 1 g

Ferroceneacetic Acid

Sign In for Pricing
View Details
MRPS35 (NM_021821) Human Over-expression Lysate
LY402879 100 µg

MRPS35 (NM_021821) Human Over-expression Lysate

Sign In for Pricing
View Details
BANF2 (NM_001014977) Human Over-expression Lysate
LY423098 100 µg

BANF2 (NM_001014977) Human Over-expression Lysate

Sign In for Pricing
View Details
Imperatorin
TRC-I495000-5MG 5 mg

Imperatorin

Sign In for Pricing
View Details
ASH2L Recombinant Rabbit Monoclonal Antibody [ST47-01]
ET1609-24 100 µL

ASH2L Recombinant Rabbit Monoclonal Antibody [ST47-01]

Sign In for Pricing
View Details
LMAN1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C5]
TA502237BM 100 µL

LMAN1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C5]

Sign In for Pricing
View Details