Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 2-26 (HV226), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 2-26 (HV226), Biotinylated spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 2-26 IGHV2-26

UniProt

A0A0B4J1V2

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTLKESGPVLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Omentum
CS800443 5x 5 µm

Tissue FFPE Sections, Omentum

Sign In for Pricing
View Details
Human ZNF467 activation kit by CRISPRa
GA116176 1 Kit

Human ZNF467 activation kit by CRISPRa

Sign In for Pricing
View Details
FSD1 Human Gene Knockout Kit (CRISPR)
KN400994 1 Kit

FSD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SCCPDH (NM_016002) Human Recombinant Protein
TP306072L 1 mg

SCCPDH (NM_016002) Human Recombinant Protein

Sign In for Pricing
View Details
MAGEA4 Mouse Monoclonal Capture Antibody [Clone ID: OTI1F9]
TA600567 100 µL

MAGEA4 Mouse Monoclonal Capture Antibody [Clone ID: OTI1F9]

Sign In for Pricing
View Details
CXCL12/SDF1 Rabbit Polyclonal Antibody
ER1802-6 100 µL

CXCL12/SDF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details