Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 2-26 (HV226), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 2-26 (HV226), Biotinylated spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 2-26 IGHV2-26

UniProt

A0A0B4J1V2

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTLKESGPVLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NeuN (RBFOX3) activation kit by CRISPRa
GA115573 1 Kit

Human NeuN (RBFOX3) activation kit by CRISPRa

Sign In for Pricing
View Details
RPS13 Antibody
8C14096-AAT 50 µg

RPS13 Antibody

Sign In for Pricing
View Details
Diethyl Succinate
TRC-D445060-5G 5 g

Diethyl Succinate

Sign In for Pricing
View Details
Upifitamab Biosimilar - Research Grade
ICH5094-20mg 20 mg

Upifitamab Biosimilar - Research Grade

Sign In for Pricing
View Details
Mouse VCAM1 Recombinant Rabbit monoclonal Antibody
HA723830B 100 µL

Mouse VCAM1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Mouse Cyp2b13 activation kit by CRISPRa
GA200980 1 Kit

Mouse Cyp2b13 activation kit by CRISPRa

Sign In for Pricing
View Details